DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32641 and ARL2

DIOPT Version :9

Sequence 1:NP_727675.1 Gene:CG32641 / 318136 FlyBaseID:FBgn0052641 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_176206.2 Gene:ARL2 / 842292 AraportID:AT1G59980 Length:414 Species:Arabidopsis thaliana


Alignment Length:126 Identity:42/126 - (33%)
Similarity:60/126 - (47%) Gaps:26/126 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EEDY------YMILGVDHNATDEEIRRAYKRMALIYHPDKN-KHPRTTAQFRKINEAFNVLSDAS 59
            |||.      |.:||:..|:||:||:.||:||||.|||||| ..|.....|:::..|:.||||..
plant    15 EEDELRRRNPYEVLGIPSNSTDQEIKSAYRRMALRYHPDKNPDDPVAAEMFKEVTFAYEVLSDPE 79

  Fly    60 ARRKYDASVMLSRRAHTTNNSHNSGGYQPNGSYEREMKTSDTFSTVCAVGGVLVGLFLGFG 120
            .||.||.:                 |.:..|....:::..  .|::.||..:...||...|
plant    80 NRRLYDTT-----------------GSEAVGPENEDLELD--LSSLGAVNTIFAALFNKLG 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32641NP_727675.1 DnaJ 4..65 CDD:278647 30/67 (45%)
ARL2NP_176206.2 PRK14295 11..>176 CDD:237665 42/126 (33%)
DnaJ 23..85 CDD:365959 29/61 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.