powered by:
Protein Alignment CG32641 and AT1G44160
DIOPT Version :9
Sequence 1: | NP_727675.1 |
Gene: | CG32641 / 318136 |
FlyBaseID: | FBgn0052641 |
Length: | 132 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_175080.2 |
Gene: | AT1G44160 / 841019 |
AraportID: | AT1G44160 |
Length: | 357 |
Species: | Arabidopsis thaliana |
Alignment Length: | 49 |
Identity: | 11/49 - (22%) |
Similarity: | 16/49 - (32%) |
Gaps: | 12/49 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 40 RTTAQFRKINEAFNVLSDASARRKYDASVMLSRRAHTTNNSHNSGGYQP 88
:.||.....|.....|| .:.|...::|....|||:.|
plant 112 QNTATATSTNPTLRSLS------------FIGRSKSSSNRMTESGGFMP 148
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG32641 | NP_727675.1 |
DnaJ |
4..65 |
CDD:278647 |
5/24 (21%) |
AT1G44160 | NP_175080.2 |
DnaJ_C |
178..341 |
CDD:199909 |
|
DnaJ |
<221..357 |
CDD:223560 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0714 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.