DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32641 and AT1G16680

DIOPT Version :9

Sequence 1:NP_727675.1 Gene:CG32641 / 318136 FlyBaseID:FBgn0052641 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_173112.2 Gene:AT1G16680 / 838237 AraportID:AT1G16680 Length:554 Species:Arabidopsis thaliana


Alignment Length:80 Identity:25/80 - (31%)
Similarity:44/80 - (55%) Gaps:6/80 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 IRRAYKRMALIYHPDKNK-HPRTTAQFRKINEAFNVLSDASARRKYDASVMLSRRAHTTN---NS 80
            :::.|::.|::.|||||. .|..:..|:|:..|:.||||:..||.||.  :|.:....|.   .|
plant   309 LKKDYRKKAMLVHPDKNMGSPLASESFKKLQSAYEVLSDSVKRRDYDE--LLKKEESRTKIVCQS 371

  Fly    81 HNSGGYQPNGSYERE 95
            .::..:|.:.:|..|
plant   372 SHASSHQNSAAYRSE 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32641NP_727675.1 DnaJ 4..65 CDD:278647 17/45 (38%)
AT1G16680NP_173112.2 MATE_like <105..192 CDD:415618
PTZ00341 <213..>356 CDD:173534 18/46 (39%)
DnaJ 291..355 CDD:395170 17/45 (38%)
Jiv90 388..484 CDD:405571
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.