DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32641 and AT5G59610

DIOPT Version :9

Sequence 1:NP_727675.1 Gene:CG32641 / 318136 FlyBaseID:FBgn0052641 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001330548.1 Gene:AT5G59610 / 836080 AraportID:AT5G59610 Length:279 Species:Arabidopsis thaliana


Alignment Length:117 Identity:36/117 - (30%)
Similarity:53/117 - (45%) Gaps:26/117 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YMILGVDHNATDEEIRRAYKRMALIYHPDKNKHPRTTAQFRKINEAFNVLSDASARRKYDASVML 70
            |.||||..:||.::|:|||:::||.||||.||......:|.||..|:..|.::.:||||.:.   
plant    75 YEILGVSPSATPQDIKRAYRKLALKYHPDVNKEANAQEKFLKIKHAYTTLINSDSRRKYGSD--- 136

  Fly    71 SRRAHTTNNSHNSGGYQPNGSYEREMKTSDTFSTVCAVGGVLVGLFLGFGAF 122
               :..|.:|......:.|...|.:                    |.|.|.|
plant   137 ---SRATGSSTGQTSRKGNSQVEED--------------------FYGLGEF 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32641NP_727675.1 DnaJ 4..65 CDD:278647 27/58 (47%)
AT5G59610NP_001330548.1 DnaJ 73..133 CDD:365959 26/57 (46%)
PRK14277 75..>222 CDD:184599 36/117 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.