DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32641 and GFA2

DIOPT Version :9

Sequence 1:NP_727675.1 Gene:CG32641 / 318136 FlyBaseID:FBgn0052641 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_568690.1 Gene:GFA2 / 834854 AraportID:AT5G48030 Length:456 Species:Arabidopsis thaliana


Alignment Length:145 Identity:42/145 - (28%)
Similarity:65/145 - (44%) Gaps:32/145 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EDYYMILGVDHNATDEEIRRAYKRMALIYHPDKNK-HPRTTAQFRKINEAFNVLSDASARRKYDA 66
            :|||.:|||..||.:.||::||..:|...|||.|| .|....:|:::::|:.:|.|...|..|| 
plant    93 KDYYSVLGVSKNAQEGEIKKAYYGLAKKLHPDMNKDDPEAETKFQEVSKAYEILKDKEKRDLYD- 156

  Fly    67 SVMLSRRAHTTNNSHNSGGYQPN------------------GSYEREMKTSDTFSTVCA-VGGVL 112
                 :..|.....:.|||: ||                  ||:     ..|.|:.... :||..
plant   157 -----QVGHEAFEQNASGGF-PNDQGFGGGGGGGFNPFDIFGSF-----NGDIFNMYRQDIGGQD 210

  Fly   113 VGLFLGFGAFKALSG 127
            |.:.|.....:|:.|
plant   211 VKVLLDLSFMEAVQG 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32641NP_727675.1 DnaJ 4..65 CDD:278647 24/61 (39%)
GFA2NP_568690.1 DnaJ 90..450 CDD:223560 42/145 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.