powered by:
Protein Alignment CG32641 and AT5G16650
DIOPT Version :9
Sequence 1: | NP_727675.1 |
Gene: | CG32641 / 318136 |
FlyBaseID: | FBgn0052641 |
Length: | 132 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001331446.1 |
Gene: | AT5G16650 / 831527 |
AraportID: | AT5G16650 |
Length: | 167 |
Species: | Arabidopsis thaliana |
Alignment Length: | 64 |
Identity: | 33/64 - (51%) |
Similarity: | 48/64 - (75%) |
Gaps: | 1/64 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 EDYYMILGVDHNATDEEIRRAYKRMALIYHPDKNK-HPRTTAQFRKINEAFNVLSDASARRKYD 65
:|||.||.||::||:|.||..|:::||.:||||:| ....|.:|::||||:|||.|.:.|.:||
plant 10 KDYYKILEVDYDATEELIRLNYRKLALKWHPDKHKGDSAATEKFQEINEAYNVLMDPAKRFEYD 73
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG32641 | NP_727675.1 |
DnaJ |
4..65 |
CDD:278647 |
31/61 (51%) |
AT5G16650 | NP_001331446.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0714 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
65 |
1.000 |
Inparanoid score |
I2511 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0004233 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.860 |
|
Return to query results.
Submit another query.