DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32641 and AT4G39150

DIOPT Version :9

Sequence 1:NP_727675.1 Gene:CG32641 / 318136 FlyBaseID:FBgn0052641 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001190960.1 Gene:AT4G39150 / 830070 AraportID:AT4G39150 Length:345 Species:Arabidopsis thaliana


Alignment Length:130 Identity:40/130 - (30%)
Similarity:54/130 - (41%) Gaps:28/130 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EEDYYMILGVDHNATDEEIRRAYKRMALIYHPDKNK-HPRTTAQFRKINEAFNVLSDASARRKYD 65
            |.:||.||||..:|:..||::||...|...|||||. .|:....|:.:.||:.||.|...|..||
plant     4 ESEYYDILGVKIDASGAEIKKAYYVQARQVHPDKNPGDPQAAKNFQILGEAYQVLGDPEKRTAYD 68

  Fly    66 ASVMLSRRAHTTNNSHNSGGYQPNGSYEREMKTSDTFSTVCAVGGVLVG--LFLGFGAFKALSGS 128
                                     .|.:|....|......||.|:|.|  ||..:....||:.:
plant    69 -------------------------KYGKEGVQQDAMVDPAAVFGMLFGSELFEDYVGQLALASA 108

  Fly   129  128
            plant   109  108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32641NP_727675.1 DnaJ 4..65 CDD:278647 25/61 (41%)
AT4G39150NP_001190960.1 DnaJ 2..>96 CDD:223560 36/116 (31%)
DnaJ-X 135..322 CDD:405064
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X251
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.