DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32641 and AT4G10130

DIOPT Version :9

Sequence 1:NP_727675.1 Gene:CG32641 / 318136 FlyBaseID:FBgn0052641 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001319891.1 Gene:AT4G10130 / 826604 AraportID:AT4G10130 Length:174 Species:Arabidopsis thaliana


Alignment Length:76 Identity:33/76 - (43%)
Similarity:45/76 - (59%) Gaps:4/76 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEEDYYMILGVDHNATDEEIRRAYKRMALIYHPDK-NKHPRTTA---QFRKINEAFNVLSDASAR 61
            :.|.||.||.|..:|:.||||.:|:...|..|||| |...|:::   :|.||.:|:.|||||..|
plant     8 VHETYYEILSVKEDASYEEIRNSYRSAILHSHPDKLNNTSRSSSDDEKFLKIQKAWEVLSDAELR 72

  Fly    62 RKYDASVMLSR 72
            ..||..:..||
plant    73 VVYDNDLRSSR 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32641NP_727675.1 DnaJ 4..65 CDD:278647 28/64 (44%)
AT4G10130NP_001319891.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.