powered by:
Protein Alignment CG32641 and AT2G42750
DIOPT Version :9
Sequence 1: | NP_727675.1 |
Gene: | CG32641 / 318136 |
FlyBaseID: | FBgn0052641 |
Length: | 132 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_565982.1 |
Gene: | AT2G42750 / 818875 |
AraportID: | AT2G42750 |
Length: | 344 |
Species: | Arabidopsis thaliana |
Alignment Length: | 64 |
Identity: | 26/64 - (40%) |
Similarity: | 35/64 - (54%) |
Gaps: | 1/64 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 EDYYMILGVDHNATDEEIRRAYKRMALIYHPD-KNKHPRTTAQFRKINEAFNVLSDASARRKYD 65
:|||.:||:..:||.|||::||.......||| ....|.||.....||:.:.:|||...|..||
plant 75 DDYYAVLGLLPDATQEEIKKAYYNCMKSCHPDLSGNDPETTNFCMFINDIYEILSDPVQRMVYD 138
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG32641 | NP_727675.1 |
DnaJ |
4..65 |
CDD:278647 |
24/61 (39%) |
AT2G42750 | NP_565982.1 |
DnaJ |
76..138 |
CDD:395170 |
24/61 (39%) |
Fer4_13 |
163..216 |
CDD:404280 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.