DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG32641 and TPR15

DIOPT Version :9

Sequence 1:	NP_727675.1	Gene:	CG32641 / 318136	FlyBaseID:	FBgn0052641	Length:	132	Species:	Drosophila melanogaster
Sequence 2:	NP_850351.1	Gene:	TPR15 / 818750	AraportID:	AT2G41520	Length:	1108	Species:	Arabidopsis thaliana

Alignment Length:	131	Identity:	34/131 - (25%)
Similarity:	59/131 - (45%)	Gaps:	37/131 - (28%)

- Green bases have known domain annotations that are detailed below.

  Fly     1 MEE--------DYYMILGVDHNATDEEIRRAYKRMALIYHPDK--------------------NK 37
            |||        |:::|:||..:.:..:|::||::.||.:||||                    ..
plant   967 MEEKSKEGIHLDFFLIMGVKTSDSAADIKKAYRKAALRHHPDKAAQILVRSESEGPWLKEILEEV 1031

  Fly    38 HPRTTAQFRKINEAFNVLSDASARRKYDASVMLSRRAHTTNNSH--------NSGGYQPNGSYER 94
            |......|:.|.||::||||.:.|..|:....: |:|..:..|:        :|..||.:..|.:
plant  1032 HKGADRLFKMIGEAYSVLSDPTKRSDYELEEEI-RKARASRESYRSRKAAEASSPPYQTSRRYWK 1095

  Fly    95 E 95
            :
plant  1096 D 1096

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG32641	NP_727675.1	DnaJ	4..65	CDD:278647	23/80 (29%)
TPR15	NP_850351.1	TPR repeat	553..581	CDD:276809
		TPR_11	554..628	CDD:290150
		TPR repeat	586..626	CDD:276809
		TPR_1	597..630	CDD:278916
		TPR_16	603..656	CDD:290168
		TPR repeat	631..659	CDD:276809
		TPR_11	835..901	CDD:290150
		TPR repeat	835..860	CDD:276809
		TPR repeat	869..899	CDD:276809
		TPR_11	870..933	CDD:290150
		TPR repeat	904..932	CDD:276809
		DnaJ	978..1059	CDD:278647	23/80 (29%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910