DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32641 and AT2G33735

DIOPT Version :9

Sequence 1:NP_727675.1 Gene:CG32641 / 318136 FlyBaseID:FBgn0052641 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001325042.1 Gene:AT2G33735 / 817939 AraportID:AT2G33735 Length:119 Species:Arabidopsis thaliana


Alignment Length:76 Identity:33/76 - (43%)
Similarity:52/76 - (68%) Gaps:1/76 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EDYYMILGVDHNATDEEIRRAYKRMALIYHPDKNK-HPRTTAQFRKINEAFNVLSDASARRKYDA 66
            :|:|.:|.::.:|:|:|||.::.|:||.:||||.| ....|::|::||||:.||||..||::||.
plant    21 KDHYKVLELNCDASDDEIRSSFIRLALKWHPDKFKEEDSATSRFQEINEAYQVLSDPIARQEYDK 85

  Fly    67 SVMLSRRAHTT 77
            ..|.....|.|
plant    86 KRMRRIYEHNT 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32641NP_727675.1 DnaJ 4..65 CDD:278647 28/61 (46%)
AT2G33735NP_001325042.1 DnaJ 22..84 CDD:365959 28/61 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I2511
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004233
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.