DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32641 and AT2G21510

DIOPT Version :9

Sequence 1:NP_727675.1 Gene:CG32641 / 318136 FlyBaseID:FBgn0052641 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001324689.1 Gene:AT2G21510 / 816690 AraportID:AT2G21510 Length:353 Species:Arabidopsis thaliana


Alignment Length:114 Identity:37/114 - (32%)
Similarity:49/114 - (42%) Gaps:26/114 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EEDYYMILGVDHNATDEEIRRAYKRMALIYHPDKNK-HPRTTAQFRKINEAFNVLSDASARRKYD 65
            |.:||.||||..:|:|.||::||...|...|||||. .|:....|:.:.||:.|||:...|..||
plant     4 ETEYYEILGVKTDASDAEIKKAYYLKARKVHPDKNPGDPQAAKNFQVLGEAYQVLSNPDKRAAYD 68

  Fly    66 ASVMLSRRAHTTNNSHNSGGYQPNGSYEREMKTSDTFSTVCAVGGVLVG 114
                                     .|.:|....|......||.|:|.|
plant    69 -------------------------KYGKEGVQQDAMVDPAAVFGMLFG 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32641NP_727675.1 DnaJ 4..65 CDD:278647 26/61 (43%)
AT2G21510NP_001324689.1 DnaJ 2..>92 CDD:223560 36/112 (32%)
DnaJ-X 135..325 CDD:405064
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X251
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.