DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG32641 and DNAJB14

DIOPT Version :9

Sequence 1:	NP_727675.1	Gene:	CG32641 / 318136	FlyBaseID:	FBgn0052641	Length:	132	Species:	Drosophila melanogaster
Sequence 2:	NP_001026893.1	Gene:	DNAJB14 / 79982	HGNCID:	25881	Length:	379	Species:	Homo sapiens

Alignment Length:	132	Identity:	44/132 - (33%)
Similarity:	68/132 - (51%)	Gaps:	30/132 - (22%)

- Green bases have known domain annotations that are detailed below.

  Fly     3 EDYYMILGVDHNATDEEIRRAYKRMALIYHPDKNKHPRTTAQFRKINEAFNVLSDASARRKYDAS 67
            ::||.:|||..:|.||::::||:::||.:|||||..|..|..|:||..|:.|||:...|::||
Human   107 KNYYEVLGVTKDAGDEDLKKAYRKLALKFHPDKNHAPGATDAFKKIGNAYAVLSNPEKRKQYD-- 169

  Fly    68 VMLSRRAHTTNNSHNSGGYQPNGSY------EREMKTSDTFSTVCAVGGVLVGLFLGFGAFKALS 126
                    .|.|...:..:|.||.:      |.::...|.|:           :|.| |.|.  |
Human   170 --------LTGNEEQACNHQNNGRFNFHRGCEADITPEDLFN-----------IFFG-GGFP--S 212

  Fly   127 GS 128
            ||
Human   213 GS 214

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG32641	NP_727675.1	DnaJ	4..65	CDD:278647	27/60 (45%)
DNAJB14	NP_001026893.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	55..94
		DnaJ	107..>214	CDD:223560	42/130 (32%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	219..241
		DUF1977	271..371	CDD:370429
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0714
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810