powered by:
Protein Alignment CG32641 and DNAJC22
DIOPT Version :9
Sequence 1: | NP_727675.1 |
Gene: | CG32641 / 318136 |
FlyBaseID: | FBgn0052641 |
Length: | 132 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001291873.1 |
Gene: | DNAJC22 / 79962 |
HGNCID: | 25802 |
Length: | 341 |
Species: | Homo sapiens |
Alignment Length: | 53 |
Identity: | 22/53 - (41%) |
Similarity: | 32/53 - (60%) |
Gaps: | 2/53 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 YMILGVDHNATDEEIRRAYKRMALIYHPDKNKHPRTTAQ--FRKINEAFNVLS 56
|.:||:...||:|||.|:|:.:..::|||.|......|| |.:|..|:.|||
Human 279 YQVLGLSEGATNEEIHRSYQELVKVWHPDHNLDQTEEAQRHFLEIQAAYEVLS 331
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG32641 | NP_727675.1 |
DnaJ |
4..65 |
CDD:278647 |
22/53 (42%) |
DNAJC22 | NP_001291873.1 |
DnaJ |
278..335 |
CDD:197617 |
22/53 (42%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0714 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.