DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32641 and ranbp9

DIOPT Version :9

Sequence 1:NP_727675.1 Gene:CG32641 / 318136 FlyBaseID:FBgn0052641 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001037977.1 Gene:ranbp9 / 733762 XenbaseID:XB-GENE-494852 Length:548 Species:Xenopus tropicalis


Alignment Length:112 Identity:24/112 - (21%)
Similarity:46/112 - (41%) Gaps:26/112 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 NATDEEIR----RAYKRM------------ALIYHPDKNKHPRTTAQFRKIN----EAFNVLSDA 58
            |.||.|:|    |:.|.:            .:|.:.....|..:.:|...:|    .:.| ::.:
 Frog   306 NGTDSEVRCLGNRSLKSLDGCSGSDSNCSNGIISNKAHQTHCHSKSQSSNLNVTELNSIN-MTMS 369

  Fly    59 SARRKYDASVMLSRRAHTTN--NSHNSGGYQPNGS--YEREMKTSDT 101
            .....|.::.:.....|.:|  ::..|.|:. |||  :|.|::..||
 Frog   370 HQLNSYSSNDVEMETDHYSNGFSASTSNGFL-NGSSRHEPELEECDT 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32641NP_727675.1 DnaJ 4..65 CDD:278647 12/70 (17%)
ranbp9NP_001037977.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
SPRY_RanBP9_10 44..186 CDD:293966
LisH 216..249 CDD:128913
CLTH 255..527 CDD:371161 24/112 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.