DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32641 and Dnajb14

DIOPT Version :9

Sequence 1:NP_727675.1 Gene:CG32641 / 318136 FlyBaseID:FBgn0052641 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001028327.1 Gene:Dnajb14 / 70604 MGIID:1917854 Length:379 Species:Mus musculus


Alignment Length:130 Identity:42/130 - (32%)
Similarity:69/130 - (53%) Gaps:5/130 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EDYYMILGVDHNATDEEIRRAYKRMALIYHPDKNKHPRTTAQFRKINEAFNVLSDASARRKYDAS 67
            ::||.:|||..:|.||::::||:::||.:|||||..|..|..|:||..|:.|||:...|::||  
Mouse   107 KNYYEVLGVTKDAGDEDLKKAYRKLALKFHPDKNHAPGATDAFKKIGNAYAVLSNPEKRKQYD-- 169

  Fly    68 VMLSRRAHTTNNSHNSGGYQPNGSYEREMKTSDTFSTVCAVGGVLVGLFLGFGAFKALSGSNNNH 132
              |:.......|..|:|.:..:...|.::...|.|: :...||...|....|...:|.....:.|
Mouse   170 --LTGSEEQACNHQNNGRFNFHRGCEADITPEDLFN-IFFGGGFPSGSVHSFSNGRAAYSHQHQH 231

  Fly   133  132
            Mouse   232  231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32641NP_727675.1 DnaJ 4..65 CDD:278647 27/60 (45%)
Dnajb14NP_001028327.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 56..90
DnaJ 107..>214 CDD:223560 38/111 (34%)
DnaJ 108..169 CDD:278647 27/60 (45%)
DUF1977 271..371 CDD:286411
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.