Sequence 1: | NP_727675.1 | Gene: | CG32641 / 318136 | FlyBaseID: | FBgn0052641 | Length: | 132 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_067292.2 | Gene: | Dnajb7 / 57755 | MGIID: | 1914012 | Length: | 312 | Species: | Mus musculus |
Alignment Length: | 113 | Identity: | 37/113 - (32%) |
---|---|---|---|
Similarity: | 55/113 - (48%) | Gaps: | 25/113 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 DYYMILGVDHNATDEEIRRAYKRMALIYHPDKNKHPRTTAQ--FRKINEAFNVLSDASARRKYDA 66
Fly 67 SVMLSRRAHTTNNSHNSGGYQPNGSY----ERE-----MKTSDTFSTV 105 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32641 | NP_727675.1 | DnaJ | 4..65 | CDD:278647 | 27/62 (44%) |
Dnajb7 | NP_067292.2 | DnaJ | 3..66 | CDD:278647 | 27/62 (44%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 272..312 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X251 | |
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.810 |