powered by:
Protein Alignment CG32641 and Dnajb2
DIOPT Version :9
Sequence 1: | NP_727675.1 |
Gene: | CG32641 / 318136 |
FlyBaseID: | FBgn0052641 |
Length: | 132 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_036008391.1 |
Gene: | Dnajb2 / 56812 |
MGIID: | 1928739 |
Length: | 365 |
Species: | Mus musculus |
Alignment Length: | 68 |
Identity: | 16/68 - (23%) |
Similarity: | 24/68 - (35%) |
Gaps: | 21/68 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 35 KNKHPRTTAQFRKINEAFNVLSDASARRKYDASVMLSRRAHTTNNSHNSGGYQPNGSYEREMKTS 99
:|:.||.|..|...:.:|...||.|: :|..:.|.....|.:.||
Mouse 168 QNQGPRLTGPFFTFSSSFPANSDFSS---------------------SSFSFSPGAGAFRSVSTS 211
Fly 100 DTF 102
.||
Mouse 212 TTF 214
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG32641 | NP_727675.1 |
DnaJ |
4..65 |
CDD:278647 |
9/29 (31%) |
Dnajb2 | XP_036008391.1 |
PRK14294 |
102..>151 |
CDD:237664 |
|
UIM |
291..310 |
CDD:197845 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0714 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X251 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.810 |
|
Return to query results.
Submit another query.