DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32641 and Samd13

DIOPT Version :9

Sequence 1:NP_727675.1 Gene:CG32641 / 318136 FlyBaseID:FBgn0052641 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_064474.1 Gene:Samd13 / 56764 RGDID:708544 Length:223 Species:Rattus norvegicus


Alignment Length:133 Identity:43/133 - (32%)
Similarity:69/133 - (51%) Gaps:11/133 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DYYMILGVDHNATDEEIRRAYKRMALIYHPDKNKHPRTTAQ--FRKINEAFNVLSDASARRKYDA 66
            :||.:|||..:|:..:|::|:.::||..|||||...|..|:  |:::.||:.:||||..|:.||.
  Rat     3 NYYKVLGVPQDASSSDIKKAFHQLALQVHPDKNPGDREAAEEKFKQVAEAYQILSDAKKRKDYDR 67

  Fly    67 SVMLSRRAHTTNNSHNSGGYQPNGSYEREM---KTSDTFSTVCAVGGVLVGLFLGFGAF-KALSG 127
            |     |...|......|..:...::|.|:   :...||.||.....:..|.:|..|.. .:..|
  Rat    68 S-----RWSRTKEELIRGDGRDETNWEEEICSRRPRRTFQTVIEDEDLFSGDYLFTGPMTHSRRG 127

  Fly   128 SNN 130
            |:|
  Rat   128 SSN 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32641NP_727675.1 DnaJ 4..65 CDD:278647 25/62 (40%)
Samd13NP_064474.1 DnaJ 2..>67 CDD:223560 26/63 (41%)
DnaJ 3..66 CDD:278647 25/62 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X251
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.