DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32641 and dnajc25

DIOPT Version :9

Sequence 1:NP_727675.1 Gene:CG32641 / 318136 FlyBaseID:FBgn0052641 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001011497.1 Gene:dnajc25 / 496999 XenbaseID:XB-GENE-954361 Length:368 Species:Xenopus tropicalis


Alignment Length:71 Identity:24/71 - (33%)
Similarity:37/71 - (52%) Gaps:11/71 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YMILGVDHNATDEEIRRAYKRMALIYHPDKNK---------HPRTTAQ--FRKINEAFNVLSDAS 59
            |.:|||..:|:..:|.|||:::|..||||:.:         ..|.:||  |..:..|:..|.|..
 Frog    59 YDVLGVSRDASKGDIARAYRQLARKYHPDRYRPGEPPGPDGETRESAQEKFLLVATAYETLKDEE 123

  Fly    60 ARRKYD 65
            .|:.||
 Frog   124 TRKDYD 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32641NP_727675.1 DnaJ 4..65 CDD:278647 22/69 (32%)
dnajc25NP_001011497.1 DnaJ 59..>137 CDD:223560 24/71 (34%)
DnaJ 59..129 CDD:278647 22/69 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.