DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32641 and dnajc3

DIOPT Version :9

Sequence 1:NP_727675.1 Gene:CG32641 / 318136 FlyBaseID:FBgn0052641 Length:132 Species:Drosophila melanogaster
Sequence 2:XP_012812335.1 Gene:dnajc3 / 496977 XenbaseID:XB-GENE-997043 Length:504 Species:Xenopus tropicalis


Alignment Length:102 Identity:32/102 - (31%)
Similarity:49/102 - (48%) Gaps:12/102 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EEDYYMILGVDHNATDEEIRRAYKRMALIYHP----DKNKHPRTTAQFRKINEAFNVLSDASARR 62
            :.|||.||||..||..:||.:||:::|..:||    |:.:..:...:|..|..|..||:|...|.
 Frog   392 KRDYYKILGVKRNAKKQEIIKAYRKLAQQWHPDNFQDEEEKKKAEKKFIDIASAKEVLTDPEKRS 456

  Fly    63 KYDA--------SVMLSRRAHTTNNSHNSGGYQPNGS 91
            ::||        |...:...|.....:...|:.|.||
 Frog   457 RFDAGEDPLDPESQQGAGGPHFHRGWNQWQGFNPFGS 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32641NP_727675.1 DnaJ 4..65 CDD:278647 24/64 (38%)
dnajc3XP_012812335.1 TPR repeat 37..65 CDD:276809
PEP_TPR_lipo 47..>366 CDD:274350
TPR repeat 70..100 CDD:276809
TPR repeat 105..133 CDD:276809
TPR repeat 154..182 CDD:276809
TPR repeat 187..217 CDD:276809
TPR repeat 222..250 CDD:276809
TPR repeat 256..281 CDD:276809
TPR repeat 300..335 CDD:276809
TPR repeat 340..368 CDD:276809
TPR repeat 374..397 CDD:276809 2/4 (50%)
DnaJ 392..>494 CDD:223560 32/102 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.