DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32641 and AgaP_AGAP001859

DIOPT Version :9

Sequence 1:NP_727675.1 Gene:CG32641 / 318136 FlyBaseID:FBgn0052641 Length:132 Species:Drosophila melanogaster
Sequence 2:XP_001238449.2 Gene:AgaP_AGAP001859 / 4577058 VectorBaseID:AGAP001859 Length:385 Species:Anopheles gambiae


Alignment Length:141 Identity:42/141 - (29%)
Similarity:62/141 - (43%) Gaps:27/141 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EDYYMILGVDHNATDEEIRRAYKRMALIYHPDKNKHPRTTAQFRKINEAFNVLSDASARRKYDAS 67
            :|:|.:|||...|||.||::.||:.||..||||||.|.....|:.:..|...|:|...|:.||  
Mosquito   113 KDFYEVLGVTQEATDSEIKKCYKKHALQLHPDKNKAPGAMEAFKSLGNAVETLTDPQKRKAYD-- 175

  Fly    68 VMLSR---------RAHTTNNSHNSG--GYQPNGSYEREMKTSDTFSTVCAVGGVLVGLFLGFGA 121
              |.|         ||..:|..:..|  |:.....::..:..:|.|:           :|.| |.
Mosquito   176 --LYRTTGGGPAGTRARASNGGYTYGQNGFNFQSDFDTGINPNDLFN-----------MFFG-GG 226

  Fly   122 FKALSGSNNNH 132
            |......:..|
Mosquito   227 FPQQQQQHTQH 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32641NP_727675.1 DnaJ 4..65 CDD:278647 26/60 (43%)
AgaP_AGAP001859XP_001238449.2 DnaJ 113..>221 CDD:223560 37/122 (30%)
DnaJ 114..175 CDD:278647 26/60 (43%)
DUF1977 280..377 CDD:286411
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.