DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32641 and Droj2

DIOPT Version :9

Sequence 1:NP_727675.1 Gene:CG32641 / 318136 FlyBaseID:FBgn0052641 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster


Alignment Length:64 Identity:33/64 - (51%)
Similarity:46/64 - (71%) Gaps:2/64 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EEDYYMILGVDHNATDEEIRRAYKRMALIYHPDKNKHPRTTAQFRKINEAFNVLSDASARRKYD 65
            |..||.||||..|||.:|:::||:::||.||||||  |....:|:.|::|:.|||||..|:.||
  Fly     4 ETGYYDILGVKPNATPDELKKAYRKLALKYHPDKN--PNEGEKFKAISQAYEVLSDADKRQVYD 65

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32641NP_727675.1 DnaJ 4..65 CDD:278647 30/60 (50%)
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 33/64 (52%)
DnaJ 7..65 CDD:278647 30/59 (51%)
DnaJ_C 112..336 CDD:199909
DnaJ_zf 140..206 CDD:199908
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.