DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG32641 and CG8531

DIOPT Version :9

Sequence 1:	NP_727675.1	Gene:	CG32641 / 318136	FlyBaseID:	FBgn0052641	Length:	132	Species:	Drosophila melanogaster
Sequence 2:	NP_610945.1	Gene:	CG8531 / 36584	FlyBaseID:	FBgn0033918	Length:	545	Species:	Drosophila melanogaster

Alignment Length:	70	Identity:	24/70 - (34%)
Similarity:	39/70 - (55%)	Gaps:	4/70 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly     1 MEEDYYMILGVDHNATDEEIRRAYKRMALIYHPDKNKHP----RTTAQFRKINEAFNVLSDASAR 61
            ::|:||..|.:..:||.|:|..||::.:.::||||:..|    .....|.:...|:.||||...|
  Fly    12 LDENYYTFLNLPRDATAEQINTAYRKQSRMFHPDKHLDPDSKKMAEIMFNRTKRAYEVLSDPQQR 76

  Fly    62 RKYDA 66
            ..||:
  Fly    77 AIYDS 81

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG32641	NP_727675.1	DnaJ	4..65	CDD:278647	21/64 (33%)
CG8531	NP_610945.1	DnaJ	15..>91	CDD:223560	23/67 (34%)
		DnaJ	15..80	CDD:278647	21/64 (33%)
		DUF3395	409..538	CDD:288708
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.910