DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32641 and dnajc21

DIOPT Version :9

Sequence 1:NP_727675.1 Gene:CG32641 / 318136 FlyBaseID:FBgn0052641 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_956338.1 Gene:dnajc21 / 336984 ZFINID:ZDB-GENE-030131-8928 Length:545 Species:Danio rerio


Alignment Length:112 Identity:36/112 - (32%)
Similarity:56/112 - (50%) Gaps:22/112 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YYMILGVDHNATDEEIRRAYKRMALIYHPDKNKHPRTTA--QFRKINEAFNVLSDASARRKYDAS 67
            :|.:|||..:|:|:::::||:::||.:|||||......|  ||:.|..|::||||...|..||  
Zfish     4 HYEVLGVKRDASDDDLKKAYRKLALKWHPDKNLDNAEDAAEQFKLIQAAYDVLSDPQERAWYD-- 66

  Fly    68 VMLSRRAHTTNNSHN----SGGYQPNGSYEREMKTSDTFSTVCAVGG 110
                        :|.    .||.  :|.|:.:......|.||....|
Zfish    67 ------------NHREALLKGGV--SGEYQDDSIDLVQFFTVTCYSG 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32641NP_727675.1 DnaJ 4..65 CDD:278647 25/61 (41%)
dnajc21NP_956338.1 DnaJ 3..66 CDD:278647 25/61 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 122..141
DBINO <183..246 CDD:290603
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 276..302
zf-C2H2_jaz 323..348 CDD:288983
C2H2 Zn finger 325..347 CDD:275371
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 331..497
C2H2 Zn finger 500..522 CDD:275371
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 522..545
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.