DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG32641 and dnaja3a

DIOPT Version :9

Sequence 1:	NP_727675.1	Gene:	CG32641 / 318136	FlyBaseID:	FBgn0052641	Length:	132	Species:	Drosophila melanogaster
Sequence 2:	XP_005168528.1	Gene:	dnaja3a / 335894	ZFINID:	ZDB-GENE-030131-7837	Length:	475	Species:	Danio rerio

Alignment Length:	133	Identity:	43/133 - (32%)
Similarity:	67/133 - (50%)	Gaps:	26/133 - (19%)

- Green bases have known domain annotations that are detailed below.

  Fly     2 EEDYYMILGVDHNATDEEIRRAYKRMALIYHPDKNKH-PRTTAQFRKINEAFNVLSDASARRKYD 65
            ::|:|.||||..:||.:||::||.:||..||||.||. |:...:|.::.||:.||||...|::||
Zfish    89 KQDFYQILGVPRSATQKEIKKAYYQMAKKYHPDTNKEDPQAKEKFAQLAEAYEVLSDEVKRKQYD 153

  Fly    66 ---ASVMLSRRAHTTNNSHNSGG--YQPNGSYEREMKTSDTFSTVCAVGGVLVGLF---LGFGAF 122
               ::...:.||...:..:..||  ..|...:.:                 :.|.|   .|||.|
Zfish   154 TYGSAGFDAGRAGAGHQQYWGGGTSIDPEELFRK-----------------IFGEFSGAQGFGDF 201

  Fly   123 KAL 125
            .|:
Zfish   202 NAI 204

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG32641	NP_727675.1	DnaJ	4..65	CDD:278647	29/61 (48%)
dnaja3a	XP_005168528.1	DnaJ	89..474	CDD:223560	43/133 (32%)
		DnaJ	91..153	CDD:278647	29/61 (48%)
		DnaJ_C	207..416	CDD:199909
		DnaJ_zf	236..296	CDD:199908
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910