DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32641 and DNAJC4

DIOPT Version :9

Sequence 1:NP_727675.1 Gene:CG32641 / 318136 FlyBaseID:FBgn0052641 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001294909.1 Gene:DNAJC4 / 3338 HGNCID:5271 Length:249 Species:Homo sapiens


Alignment Length:155 Identity:40/155 - (25%)
Similarity:71/155 - (45%) Gaps:32/155 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YYMILGVDHNATDEEIRRAYKRMALIYHPDKNK-HPRTTAQFRKINEAFNVLSDASARRKYD--- 65
            ||.:|||...|:.||::||:...:...|||::. :|...::|.:::||:.|||...:||.||   
Human    35 YYELLGVHPGASTEEVKRAFFSKSKELHPDRDPGNPSLHSRFVELSEAYRVLSREQSRRSYDDQL 99

  Fly    66 ---------ASVMLSRRAHTTNNSHNSGGYQPNGSY---------------EREMKTSDTFSTVC 106
                     .:.:..:.||.|   |:|....||..|               :::.|.:......|
Human   100 RSGSPPKSPRTTVHDKSAHQT---HSSSWTPPNAQYWSQFHSVRPQGPQLRQQQHKQNKQVLGYC 161

  Fly   107 AVGGVLVGLFLGFGAFKALSGSNNN 131
            .: .:|.|:.|.:.||:.:...:.|
Human   162 LL-LMLAGMGLHYIAFRKVKQMHLN 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32641NP_727675.1 DnaJ 4..65 CDD:278647 22/60 (37%)
DNAJC4NP_001294909.1 DnaJ 34..96 CDD:278647 22/60 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.