powered by:
Protein Alignment CG32641 and CG32727
DIOPT Version :9
Sequence 1: | NP_727675.1 |
Gene: | CG32641 / 318136 |
FlyBaseID: | FBgn0052641 |
Length: | 132 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_727185.1 |
Gene: | CG32727 / 318176 |
FlyBaseID: | FBgn0265265 |
Length: | 122 |
Species: | Drosophila melanogaster |
Alignment Length: | 40 |
Identity: | 15/40 - (37%) |
Similarity: | 18/40 - (45%) |
Gaps: | 6/40 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 ILGVDHNATDEEIRRAYKRMALIYHPDKNKHPRTTAQFRK 47
||.:..|| ..|||| .|..|||:|..|....:..|
Fly 76 ILSISPNA--PWIRRA----MLAKHPDRNGSPYLAGKIHK 109
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG32641 | NP_727675.1 |
DnaJ |
4..65 |
CDD:278647 |
15/40 (38%) |
CG32727 | NP_727185.1 |
DnaJ |
<34..115 |
CDD:295354 |
15/40 (38%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.