DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32641 and CG32640

DIOPT Version :9

Sequence 1:NP_727675.1 Gene:CG32641 / 318136 FlyBaseID:FBgn0052641 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_727674.1 Gene:CG32640 / 318135 FlyBaseID:FBgn0052640 Length:132 Species:Drosophila melanogaster


Alignment Length:132 Identity:132/132 - (100%)
Similarity:132/132 - (100%) Gaps:0/132 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEEDYYMILGVDHNATDEEIRRAYKRMALIYHPDKNKHPRTTAQFRKINEAFNVLSDASARRKYD 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly     1 MEEDYYMILGVDHNATDEEIRRAYKRMALIYHPDKNKHPRTTAQFRKINEAFNVLSDASARRKYD 65

  Fly    66 ASVMLSRRAHTTNNSHNSGGYQPNGSYEREMKTSDTFSTVCAVGGVLVGLFLGFGAFKALSGSNN 130
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly    66 ASVMLSRRAHTTNNSHNSGGYQPNGSYEREMKTSDTFSTVCAVGGVLVGLFLGFGAFKALSGSNN 130

  Fly   131 NH 132
            ||
  Fly   131 NH 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32641NP_727675.1 DnaJ 4..65 CDD:278647 60/60 (100%)
CG32640NP_727674.1 DnaJ 4..65 CDD:278647 60/60 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447083
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.