DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG32641 and SPAC4H3.01

DIOPT Version :9

Sequence 1:	NP_727675.1	Gene:	CG32641 / 318136	FlyBaseID:	FBgn0052641	Length:	132	Species:	Drosophila melanogaster
Sequence 2:	NP_594337.1	Gene:	SPAC4H3.01 / 2543672	PomBaseID:	SPAC4H3.01	Length:	392	Species:	Schizosaccharomyces pombe

Alignment Length:	67	Identity:	28/67 - (41%)
Similarity:	48/67 - (71%)	Gaps:	2/67 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly     1 MEEDYYMILGVDHNATDEEIRRAYKRMALIYHPDKN-KHPR-TTAQFRKINEAFNVLSDASARRK 63
            ::.:||.:||:..:||..:|::||:::|:.|||||| ..|: .:.:|:||:||:.||.|...|.:
pombe     5 VDTEYYDLLGISTDATAVDIKKAYRKLAVKYHPDKNPDDPQGASEKFQKISEAYQVLGDEKLRSQ 69

  Fly    64 YD 65
            ||
pombe    70 YD 71

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG32641	NP_727675.1	DnaJ	4..65	CDD:278647	26/62 (42%)
SPAC4H3.01	NP_594337.1	DnaJ	7..>101	CDD:223560	28/65 (43%)
		DnaJ	8..71	CDD:278647	26/62 (42%)
		DnaJ-X	173..373	CDD:291006
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	1	1.000	-	-		X251
TreeFam	0	0.000	Not matched by this tool.
	2	1.910