DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG32641 and SPBC3E7.11c

DIOPT Version :9

Sequence 1:	NP_727675.1	Gene:	CG32641 / 318136	FlyBaseID:	FBgn0052641	Length:	132	Species:	Drosophila melanogaster
Sequence 2:	NP_596098.1	Gene:	SPBC3E7.11c / 2540676	PomBaseID:	SPBC3E7.11c	Length:	355	Species:	Schizosaccharomyces pombe

Alignment Length:	67	Identity:	29/67 - (43%)
Similarity:	46/67 - (68%)	Gaps:	2/67 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly     1 MEEDYYMILGVDHNATDEEIRRAYKRMALIYHPDKNKHPRTTA--QFRKINEAFNVLSDASARRK 63
            ::.|||.||.:..:|..:.|:::|:|:|::||||||:.....|  :|:|:.||:.||||...|.|
pombe     6 VDRDYYDILNISVDADGDTIKKSYRRLAILYHPDKNRENPEAAREKFQKLAEAYQVLSDPKLREK 70

  Fly    64 YD 65
            ||
pombe    71 YD 72

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG32641	NP_727675.1	DnaJ	4..65	CDD:278647	27/62 (44%)
SPBC3E7.11c	NP_596098.1	DnaJ	8..>102	CDD:223560	29/65 (45%)
		DnaJ	9..72	CDD:278647	27/62 (44%)
		DnaJ-X	150..350	CDD:291006
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	1	1.000	-	-		X251
TreeFam	0	0.000	Not matched by this tool.
	2	1.910