DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG32641 and SPCC63.03

DIOPT Version :9

Sequence 1:	NP_727675.1	Gene:	CG32641 / 318136	FlyBaseID:	FBgn0052641	Length:	132	Species:	Drosophila melanogaster
Sequence 2:	NP_587977.2	Gene:	SPCC63.03 / 2539584	PomBaseID:	SPCC63.03	Length:	612	Species:	Schizosaccharomyces pombe

Alignment Length:	72	Identity:	24/72 - (33%)
Similarity:	44/72 - (61%)	Gaps:	7/72 - (9%)

- Green bases have known domain annotations that are detailed below.

  Fly     1 MEE----DYYMILGVDHNATDEEIRRAYKRMALIYHPDKNKHPRTTA---QFRKINEAFNVLSDA 58
            |:|    :.|:.||:..:||.::|:.:|.|::.::|||::...:..|   :|:.|..|:.||||.
pombe     1 MDEADSWELYLALGLPKDATSDQIKESYYRLSRLFHPDRHTADQKAAAEEKFQIIQHAYEVLSDP 65

  Fly    59 SARRKYD 65
            |.:..||
pombe    66 SKKEIYD 72

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG32641	NP_727675.1	DnaJ	4..65	CDD:278647	20/63 (32%)
SPCC63.03	NP_587977.2	DnaJ	8..>80	CDD:223560	22/65 (34%)
		DnaJ	8..72	CDD:278647	20/63 (32%)
		DUF3395	489..604	CDD:288708
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910