DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32641 and mdj1

DIOPT Version :9

Sequence 1:NP_727675.1 Gene:CG32641 / 318136 FlyBaseID:FBgn0052641 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_587824.1 Gene:mdj1 / 2539501 PomBaseID:SPCC4G3.14 Length:528 Species:Schizosaccharomyces pombe


Alignment Length:125 Identity:35/125 - (28%)
Similarity:53/125 - (42%) Gaps:31/125 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DYYMILGVDHNATDEEIRRAYKRMALIYHPDKNKHPRTTAQFRKINEAFNVLSDASARRKYDASV 68
            |.|..|||..:|:..||:.||.::|..||||.|.......:|.:|.:|:.||.|...::.:|   
pombe    86 DPYKTLGVSKSASASEIKSAYYKLAKQYHPDANPDKAAQDKFVEIKQAYEVLQDPKKKKAFD--- 147

  Fly    69 MLSRRAHTTNNSHNSGGYQPNGSYEREMKTSDTFSTVCAVGGVLVGLFLGF-GAFKALSG 127
                       ::.:|.:: ||.:               .||...|...|| ||....||
pombe   148 -----------TYGAGAFK-NGEF---------------TGGDFEGFQNGFAGASSFSSG 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32641NP_727675.1 DnaJ 4..65 CDD:278647 22/60 (37%)
mdj1NP_587824.1 DnaJ 82..457 CDD:223560 35/125 (28%)
DnaJ 86..147 CDD:278647 22/60 (37%)
DnaJ_zf 243..303 CDD:199908
DnaJ_C 304..439 CDD:199909
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.