DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32641 and psi1

DIOPT Version :9

Sequence 1:NP_727675.1 Gene:CG32641 / 318136 FlyBaseID:FBgn0052641 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_588477.1 Gene:psi1 / 2539002 PomBaseID:SPCC830.07c Length:379 Species:Schizosaccharomyces pombe


Alignment Length:150 Identity:44/150 - (29%)
Similarity:61/150 - (40%) Gaps:45/150 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YMILGVDHNATDEEIRRAYKRMALIYHPDKNKHPRTTAQFRKINEAFNVLSDASARRKYD----- 65
            |..|.|...|::.|:::||:::||.||||||  |....:|::|:.|:.||||...|:.||     
pombe     8 YDCLEVRPEASEAELKKAYRKLALKYHPDKN--PNGEKKFKEISLAYEVLSDPQRRKLYDQYGIT 70

  Fly    66 ------------------------ASVMLSRRAHTTNNSHNSGGYQ------PNGSYEREMKTSD 100
                                    |....:|..|.  |....||.|      ||..:||      
pombe    71 EGNAAPPPPGAEGGPGAGFGGFPGAGPGGARTFHF--NMGGPGGAQFFSASDPNDIFER------ 127

  Fly   101 TFSTVCAVGGVLVGLFLGFG 120
            .|....|.||.:.|...|.|
pombe   128 VFGHAFAGGGGMGGGMGGMG 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32641NP_727675.1 DnaJ 4..65 CDD:278647 24/58 (41%)
psi1NP_588477.1 DnaJ 2..379 CDD:223560 43/149 (29%)
DnaJ 7..65 CDD:278647 24/58 (41%)
DnaJ_C 207..368 CDD:199909
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.