DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32641 and DNAJC16

DIOPT Version :9

Sequence 1:NP_727675.1 Gene:CG32641 / 318136 FlyBaseID:FBgn0052641 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_056106.1 Gene:DNAJC16 / 23341 HGNCID:29157 Length:782 Species:Homo sapiens


Alignment Length:97 Identity:31/97 - (31%)
Similarity:53/97 - (54%) Gaps:11/97 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEEDYYMILGVDHNATDEEIRRAYKRMALIYHPDKNKHPRTTAQFRKINEAFNVLSDASARRKYD 65
            ::.|.|.:|||...|:..:|::|||::|..:||||||.|....:|.:|::|:.:||:...|..||
Human    26 LDFDPYRVLGVSRTASQADIKKAYKKLAREWHPDKNKDPGAEDKFIQISKAYEILSNEEKRSNYD 90

  Fly    66 ASVMLSRRAHTTNNSHNSGGYQPNGSYEREMK 97
                      ...::..:.|||.. ..:||.:
Human    91 ----------QYGDAGENQGYQKQ-QQQREYR 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32641NP_727675.1 DnaJ 4..65 CDD:278647 24/60 (40%)
DNAJC16NP_056106.1 DnaJ 29..>142 CDD:333066 31/94 (33%)
TRX_DnaJ 136..245 CDD:239261
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 562..593
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.