DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32641 and DNAJC18

DIOPT Version :10

Sequence 1:NP_727675.1 Gene:CG32641 / 318136 FlyBaseID:FBgn0052641 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_689899.1 Gene:DNAJC18 / 202052 HGNCID:28429 Length:358 Species:Homo sapiens


Alignment Length:119 Identity:41/119 - (34%)
Similarity:59/119 - (49%) Gaps:20/119 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DYYMILGVDHNATDEEIRRAYKRMALIYHPDKNKHPRTTAQFRKINEAFNVLSDASARRKYD--- 65
            :||.||||..:|:|||:::||:::||.:|||||..|..|..|:.|..||.|||:...|.:||   
Human    82 NYYEILGVSRDASDEELKKAYRKLALKFHPDKNCAPGATDAFKAIGNAFAVLSNPDKRLRYDEYG 146

  Fly    66 --ASVMLSRRAHTTNNSHN--------------SGGYQPNGSYER-EMKTSDTF 102
              .....:.||...|...:              .||:.|.|:... ...|.||:
Human   147 DEQVTFTAPRARPYNYYRDFEADITPEELFNVFFGGHFPTGNIHMFSNVTDDTY 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32641NP_727675.1 PRK14299 3..>127 CDD:237667 41/119 (34%)
DnaJ 4..65 CDD:395170 29/60 (48%)
DNAJC18NP_689899.1 DnaJ_bact 83..>187 CDD:274090 37/103 (36%)
DUF1977 250..348 CDD:462754
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.