powered by:
Protein Alignment CG32641 and dnj-14
DIOPT Version :9
Sequence 1: | NP_727675.1 |
Gene: | CG32641 / 318136 |
FlyBaseID: | FBgn0052641 |
Length: | 132 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001257015.1 |
Gene: | dnj-14 / 180746 |
WormBaseID: | WBGene00001032 |
Length: | 217 |
Species: | Caenorhabditis elegans |
Alignment Length: | 62 |
Identity: | 32/62 - (51%) |
Similarity: | 44/62 - (70%) |
Gaps: | 2/62 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 YMILGVDHNATDEEIRRAYKRMALIYHPDKN--KHPRTTAQFRKINEAFNVLSDASARRKYD 65
|.:||:..||||:||::||:::||.|||||| ..|..|..|::||.|..|||:.:.||.||
Worm 40 YNVLGIQKNATDDEIKKAYRKLALRYHPDKNLDGDPEKTEMFKEINYANAVLSNPNKRRVYD 101
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG32641 | NP_727675.1 |
DnaJ |
4..65 |
CDD:278647 |
30/60 (50%) |
dnj-14 | NP_001257015.1 |
DnaJ |
39..101 |
CDD:365959 |
30/60 (50%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.