DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG32641 and dnj-26

DIOPT Version :9

Sequence 1:	NP_727675.1	Gene:	CG32641 / 318136	FlyBaseID:	FBgn0052641	Length:	132	Species:	Drosophila melanogaster
Sequence 2:	NP_502326.1	Gene:	dnj-26 / 178171	WormBaseID:	WBGene00001044	Length:	365	Species:	Caenorhabditis elegans

Alignment Length:	136	Identity:	37/136 - (27%)
Similarity:	58/136 - (42%)	Gaps:	39/136 - (28%)

- Green bases have known domain annotations that are detailed below.

  Fly     3 EDYYMILGVDHNATDEEIRRAYKRMALIYHPDKNKHPRTTAQFRKINEAFNVLSDASARRKYD-- 65
            :|:|.||.||..|:.:|||.|:::.....||||.|||..|...:.:|.||::|.|.:.||:||
Worm    26 KDFYKILNVDKKASPDEIRIAFRKRIREVHPDKCKHPSATEASKVVNNAFSLLMDPAKRRQYDLQ 90

  Fly    66 ----ASVMLSRRAHTTNN---------------------------------SHNSGGYQPNGSYE 93
                ::..|.:|.:...|                                 .|||..:|.|....
Worm    91 NAETSNENLYKRCNRNKNQRKQEYSNTQRQNHKKSEPSNGKRNEQNSSFKQDHNSKNHQSNHQKT 155

  Fly    94 REMKTS 99
            :..|::
Worm   156 KNKKSN 161

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG32641	NP_727675.1	DnaJ	4..65	CDD:278647	26/60 (43%)
dnj-26	NP_502326.1	DnaJ	27..88	CDD:365959	26/60 (43%)
dnj-26	NP_502326.1	DUF4887	<81..174	CDD:374444	13/81 (16%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0714
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810