DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32641 and F54F2.9

DIOPT Version :9

Sequence 1:NP_727675.1 Gene:CG32641 / 318136 FlyBaseID:FBgn0052641 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_498949.2 Gene:F54F2.9 / 176241 WormBaseID:WBGene00018836 Length:414 Species:Caenorhabditis elegans


Alignment Length:117 Identity:30/117 - (25%)
Similarity:55/117 - (47%) Gaps:21/117 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DYYMILGVDHNATDEEIRRAYKRMALIYHPDKNKHPRTTAQFRKINEAFNVLSDASARRKYDASV 68
            ::|....:..:|:..::::||:::.|.:|||:|..|..|.:||::...:.||.....|.|||   
 Worm    35 NFYEWFDIPRDASSNQVKKAYRKLTLEWHPDRNSAPDATEKFRQVAGIYEVLKTTELREKYD--- 96

  Fly    69 MLSRRAHTTNNSHNSG--GYQPNGSYEREMKTSDTFSTVCAVGGVLVGLFLG 118
                      |...:|  .::....|.|.|:....:.      |:||.||:|
 Worm    97 ----------NVLENGLPSWRHPMYYYRRMRKLAWYE------GILVLLFIG 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32641NP_727675.1 DnaJ 4..65 CDD:278647 17/60 (28%)
F54F2.9NP_498949.2 DnaJ 35..96 CDD:278647 17/60 (28%)
SANT 357..402 CDD:238096
SANT 357..402 CDD:197842
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.