powered by:
Protein Alignment CG32641 and dnj-29
DIOPT Version :9
Sequence 1: | NP_727675.1 |
Gene: | CG32641 / 318136 |
FlyBaseID: | FBgn0052641 |
Length: | 132 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001369819.1 |
Gene: | dnj-29 / 173278 |
WormBaseID: | WBGene00001047 |
Length: | 752 |
Species: | Caenorhabditis elegans |
Alignment Length: | 66 |
Identity: | 25/66 - (37%) |
Similarity: | 40/66 - (60%) |
Gaps: | 7/66 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 EDY--YMILGVDHNATDEEIRRAYKRMALIYHPDKNKHPRTTAQ-FRKINEAFNVLSDASARRKY 64
:|| |.|||:|..|.::.|::|::.|:.|:|||:. ..|| |.||.:|...|:|..||..:
Worm 104 KDYDPYQILGLDQGADEKAIKKAWRDMSKIHHPDRG----GDAQFFDKIAKAHQALTDKEARENW 164
Fly 65 D 65
:
Worm 165 E 165
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG32641 | NP_727675.1 |
DnaJ |
4..65 |
CDD:278647 |
25/63 (40%) |
dnj-29 | NP_001369819.1 |
DnaJ |
107..165 |
CDD:395170 |
23/61 (38%) |
SEC63 |
212..713 |
CDD:214744 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.