powered by:
Protein Alignment CG32641 and AgaP_AGAP004849
DIOPT Version :9
Sequence 1: | NP_727675.1 |
Gene: | CG32641 / 318136 |
FlyBaseID: | FBgn0052641 |
Length: | 132 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_314342.3 |
Gene: | AgaP_AGAP004849 / 1275118 |
VectorBaseID: | AGAP004849 |
Length: | 284 |
Species: | Anopheles gambiae |
Alignment Length: | 66 |
Identity: | 22/66 - (33%) |
Similarity: | 44/66 - (66%) |
Gaps: | 3/66 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 EDYYMILGVDHNATDEEIRRAYKRMALIYHPDK---NKHPRTTAQFRKINEAFNVLSDASARRKY 64
::.|.:.||:.:|:|:||::||.|::|..|||: :.....|.:|:.:::.:|:||:..:|..|
Mosquito 14 KNIYELFGVEKSASDQEIKKAYYRLSLQTHPDRVPESDKQEATEKFKVLSKLYNILSNKDSRAIY 78
Fly 65 D 65
|
Mosquito 79 D 79
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.