DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG32641 and AgaP_AGAP002386

DIOPT Version :9

Sequence 1:	NP_727675.1	Gene:	CG32641 / 318136	FlyBaseID:	FBgn0052641	Length:	132	Species:	Drosophila melanogaster
Sequence 2:	XP_312569.5	Gene:	AgaP_AGAP002386 / 1273576	VectorBaseID:	AGAP002386	Length:	1078	Species:	Anopheles gambiae

Alignment Length:	66	Identity:	25/66 - (37%)
Similarity:	44/66 - (66%)	Gaps:	0/66 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly     3 EDYYMILGVDHNATDEEIRRAYKRMALIYHPDKNKHPRTTAQFRKINEAFNVLSDASARRKYDAS 67
            :|.|.||||..:.:.|:||:.||::|::.||||||.|.....|:.:..:|.::.:..:|::||.|
Mosquito   819 KDAYSILGVSPDCSQEQIRKHYKKIAVLVHPDKNKQPGAEEAFKVLQRSFELIGEPESRKEYDQS 883

  Fly    68 V 68
            :
Mosquito   884 L 884

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG32641	NP_727675.1	DnaJ	4..65	CDD:278647	22/60 (37%)
AgaP_AGAP002386	XP_312569.5	DnaJ	820..881	CDD:278647	22/60 (37%)
AgaP_AGAP002386	XP_312569.5	Jiv90	914..1003	CDD:291562
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910