DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG32641 and AgaP_AGAP000261

DIOPT Version :9

Sequence 1:	NP_727675.1	Gene:	CG32641 / 318136	FlyBaseID:	FBgn0052641	Length:	132	Species:	Drosophila melanogaster
Sequence 2:	XP_310857.5	Gene:	AgaP_AGAP000261 / 1271995	VectorBaseID:	AGAP000261	Length:	536	Species:	Anopheles gambiae

Alignment Length:	65	Identity:	22/65 - (33%)
Similarity:	39/65 - (60%)	Gaps:	0/65 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly     1 MEEDYYMILGVDHNATDEEIRRAYKRMALIYHPDKNKHPRTTAQFRKINEAFNVLSDASARRKYD 65
            :.|::|.:|.::..||..||:||::.::::.||||:.......:||.:...:.||.|...|.|||
Mosquito    39 VNENFYTLLNINQTATLAEIKRAFRTLSVVLHPDKSDAEDANIRFRNLVSVYEVLKDPGRREKYD 103

Fly 66 65
Mosquito 104 103

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG32641	NP_727675.1	DnaJ	4..65	CDD:278647	19/60 (32%)
AgaP_AGAP000261	XP_310857.5	DnaJ	42..103	CDD:278647	19/60 (32%)
		SANT	304..>344	CDD:197842
		SANT	307..344	CDD:238096
		SANT	399..450	CDD:197842
		SANT	401..449	CDD:238096
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910