DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32641 and AgaP_AGAP003825

DIOPT Version :9

Sequence 1:NP_727675.1 Gene:CG32641 / 318136 FlyBaseID:FBgn0052641 Length:132 Species:Drosophila melanogaster
Sequence 2:XP_310387.5 Gene:AgaP_AGAP003825 / 1271565 VectorBaseID:AGAP003825 Length:308 Species:Anopheles gambiae


Alignment Length:132 Identity:39/132 - (29%)
Similarity:60/132 - (45%) Gaps:22/132 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DYYMILGVDHNATDEEIRRAYKRMALIYHPDKN-KHPRTTAQFRKINEAFNVLSDASARRKYDAS 67
            |.|.:|.||..||::|||:||::.||..||||| .:|:....|:::::|..:|.|.|||..||..
Mosquito    11 DIYGLLEVDIAATEQEIRKAYRKKALQCHPDKNPDNPKAAQLFQELSKALEILMDVSARAAYDRL 75

  Fly    68 VMLSRRAHTTNNSHN---------------------SGGYQPNGSYEREMKTSDTFSTVCAVGGV 111
            :...:.|.......:                     ||||:...|...|....:.|..:...|..
Mosquito    76 LNAKKAAQLRTKQLDSKRQKLKADLEERERQAKEAASGGYKTASSKTPEELFQEEFKRLRKEGSK 140

  Fly   112 LV 113
            |:
Mosquito   141 LI 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32641NP_727675.1 DnaJ 4..65 CDD:278647 27/61 (44%)
AgaP_AGAP003825XP_310387.5 DnaJ 11..73 CDD:278647 27/61 (44%)
RRM_DNAJC17 173..249 CDD:240875
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.