powered by:
Protein Alignment CG32641 and AgaP_AGAP007138
DIOPT Version :9
Sequence 1: | NP_727675.1 |
Gene: | CG32641 / 318136 |
FlyBaseID: | FBgn0052641 |
Length: | 132 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_308621.4 |
Gene: | AgaP_AGAP007138 / 1269966 |
VectorBaseID: | AGAP007138 |
Length: | 440 |
Species: | Anopheles gambiae |
Alignment Length: | 66 |
Identity: | 20/66 - (30%) |
Similarity: | 34/66 - (51%) |
Gaps: | 4/66 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 EEDYYMILGVDHNATDEEIRRAYKRMALIYHPDKNK-HPRTTA---QFRKINEAFNVLSDASARR 62
|::.|.:||:...|:..||:...:.::...||||.| ..|..| :|.:|.:|...||....:|
Mosquito 366 EQNAYKVLGISATASQVEIKTLCRNLSKETHPDKVKDKSRLRAAEERFMEIQQACEALSKTRRKR 430
Fly 63 K 63
:
Mosquito 431 R 431
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG32641 | NP_727675.1 |
DnaJ |
4..65 |
CDD:278647 |
19/64 (30%) |
AgaP_AGAP007138 | XP_308621.4 |
TM2 |
87..136 |
CDD:282945 |
|
DnaJ |
368..424 |
CDD:278647 |
16/55 (29%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0714 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.