DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32641 and AgaP_AGAP007620

DIOPT Version :9

Sequence 1:NP_727675.1 Gene:CG32641 / 318136 FlyBaseID:FBgn0052641 Length:132 Species:Drosophila melanogaster
Sequence 2:XP_308251.4 Gene:AgaP_AGAP007620 / 1269608 VectorBaseID:AGAP007620 Length:217 Species:Anopheles gambiae


Alignment Length:146 Identity:39/146 - (26%)
Similarity:62/146 - (42%) Gaps:41/146 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YMILGVDHNATDEEIRRAYKRMALIYHPDKN-KHPRTTAQFRKINEAFNVLSDASARRKYDASVM 69
            |..||:...||.:||::.|:::||.|||||| .:|....:|:::|.|.::|||.:.|..||    
Mosquito    14 YQTLGLQKTATADEIKKTYRKLALKYHPDKNPNNPDAADKFKEVNRAHSILSDLTKRNIYD---- 74

  Fly    70 LSRRAHTTNNSHNSGGYQPNGSYERE-----------MKTSDTFSTVCAVGGVLVGLF------- 116
                           .|...|.|..|           :.||.|...:..:.|::.|.:       
Mosquito    75 ---------------NYGSLGLYIAEQFGEENVNAYFVVTSPTCKALFMICGIITGCYCCCCCCC 124

  Fly   117 ---LGFGAFKALSGSN 129
               ..||.:|.:...|
Mosquito   125 CCNFCFGKYKPVPPEN 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32641NP_727675.1 DnaJ 4..65 CDD:278647 24/59 (41%)
AgaP_AGAP007620XP_308251.4 DnaJ 12..74 CDD:278647 24/59 (41%)
DnaJ 14..>81 CDD:223560 27/85 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.