powered by:
Protein Alignment CG32641 and dnaja3
DIOPT Version :9
Sequence 1: | NP_727675.1 |
Gene: | CG32641 / 318136 |
FlyBaseID: | FBgn0052641 |
Length: | 132 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001120377.1 |
Gene: | dnaja3 / 100145451 |
XenbaseID: | XB-GENE-5718163 |
Length: | 457 |
Species: | Xenopus tropicalis |
Alignment Length: | 63 |
Identity: | 29/63 - (46%) |
Similarity: | 44/63 - (69%) |
Gaps: | 1/63 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 DYYMILGVDHNATDEEIRRAYKRMALIYHPDKNKH-PRTTAQFRKINEAFNVLSDASARRKYD 65
|:|.:|||..||:.:||::||.::|..||||.||. |:...:|.::.||:.||||...|::||
Frog 67 DFYQVLGVPRNASQKEIKKAYYQLAKKYHPDTNKEDPQAKEKFSQLAEAYEVLSDEVKRKQYD 129
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.