powered by:
Protein Alignment CG32641 and dnajb12b
DIOPT Version :9
Sequence 1: | NP_727675.1 |
Gene: | CG32641 / 318136 |
FlyBaseID: | FBgn0052641 |
Length: | 132 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001082977.1 |
Gene: | dnajb12b / 100037354 |
ZFINID: | ZDB-GENE-070410-128 |
Length: | 159 |
Species: | Danio rerio |
Alignment Length: | 44 |
Identity: | 19/44 - (43%) |
Similarity: | 34/44 - (77%) |
Gaps: | 0/44 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 EDYYMILGVDHNATDEEIRRAYKRMALIYHPDKNKHPRTTAQFR 46
::||.||||..:|:::::::||:::||.:|||||..|..|..|:
Zfish 108 KNYYEILGVQKDASEDDLKKAYRKLALKFHPDKNHAPGATEAFK 151
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG32641 | NP_727675.1 |
DnaJ |
4..65 |
CDD:278647 |
19/43 (44%) |
dnajb12b | NP_001082977.1 |
DnaJ |
109..>151 |
CDD:278647 |
18/41 (44%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.