DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32640 and DNAJA3

DIOPT Version :9

Sequence 1:NP_727674.1 Gene:CG32640 / 318135 FlyBaseID:FBgn0052640 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_005138.3 Gene:DNAJA3 / 9093 HGNCID:11808 Length:480 Species:Homo sapiens


Alignment Length:91 Identity:37/91 - (40%)
Similarity:53/91 - (58%) Gaps:15/91 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EEDYYMILGVDHNATDEEIRRAYKRMALIYHPDKNK-HPRTTAQFRKINEAFNVLSDASARRKYD 65
            :||||.||||..||:.:||::||.::|..||||.|| .|:...:|.::.||:.||||...|::||
Human    91 KEDYYQILGVPRNASQKEIKKAYYQLAKKYHPDTNKDDPKAKEKFSQLAEAYEVLSDEVKRKQYD 155

  Fly    66 ASVMLSRRAHTTNNSHNSGGYQPNGS 91
            |              :.|.|:.|..|
Human   156 A--------------YGSAGFDPGAS 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32640NP_727674.1 DnaJ 4..65 CDD:278647 29/61 (48%)
DNAJA3NP_005138.3 DnaJ 90..480 CDD:223560 37/91 (41%)
DnaJ 93..155 CDD:278647 29/61 (48%)
DnaJ_C 207..416 CDD:199909
DnaJ_zf 236..296 CDD:199908
CXXCXGXG motif 236..243
CXXCXGXG motif 253..260
CXXCXGXG motif 275..282
CXXCXGXG motif 289..296
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 443..471
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.