DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32640 and JEM1

DIOPT Version :10

Sequence 1:NP_727674.1 Gene:CG32640 / 318135 FlyBaseID:FBgn0052640 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_012462.3 Gene:JEM1 / 853372 SGDID:S000003609 Length:645 Species:Saccharomyces cerevisiae


Alignment Length:94 Identity:36/94 - (38%)
Similarity:50/94 - (53%) Gaps:11/94 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EEDYYMILGVDHNATDEEIRRAYKRMALIYHPDKNKHPRTTAQ------FRKINEAFNVLSDASA 60
            ::|||.||||..:|:.:|||:||..:...|||||.|......|      ..:||||:..|||...
Yeast   536 KKDYYKILGVSPSASSKEIRKAYLNLTKKYHPDKIKANHNDKQESIHETMSQINEAYETLSDDDK 600

  Fly    61 RRKYDASVMLSRRAHTTNNSHNSGGYQPN 89
            |::||.|     |::...|:...|..|.|
Yeast   601 RKEYDLS-----RSNPRRNTFPQGPRQNN 624

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32640NP_727674.1 PRK14299 3..>127 CDD:237667 36/93 (39%)
DnaJ 4..65 CDD:395170 28/66 (42%)
JEM1NP_012462.3 DnaJ 538..>613 CDD:440252 32/79 (41%)

Return to query results.
Submit another query.